TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9LRC0|C9LRC0_9FIRM Uncharacterized protein OS=Dialister invisus DSM 15470 GN=GCWU000321_00394 PE=4 SV=1
MNDKIKWWLNGIGAIIFLALAVVYLLIRPIVVQNLEPVIQDAVKEKINGTLVWRTMDLDPRYNLSFDFVELKDKEGKDVL
KSANVTISWSAGALYNYLMHDGDLFNVVSGITMEEPMMTVRERKDGQWNVQELVKHSADESAGEFHGSVALKNGNLKVET
QTGDIYTFERVECDLTRGGDEKIKGTLAGEFLKVPFDGDLSYTDENNFEGNIQTEPASLQFLKPLIEKMPGAVHSFDIRN
GMGEVTGARIWRSDGVLSYHVKGRLDQTAVSYENYALTDVAAFFDICDGVLQIENFSGKVNGQIIAGSGAMNWKGEDPLI
SGNVNFSYLDASKVILTEDVKGYATGNVHIGGSLSNPVLTGKISVKDVCCRNVLIQDGSAAFDYGERTLALSSLMIHMAG
GTVTGKGKYSFSTGDFNGEITVEDISAGDIPLGYDLSGIINGSVIAQGNYFDGSMTLYSATAAGKGQNISYNGNSASFIT
GEGIYKNGRWTSTFTGDGVEVNGLCADSIAGEIAAHDDTYEISYLNGQSGEGIFSINGIYVADDMSIRAVGTNLDMAQFS
EFVDINLAGRTSFDMRITGSESLPSFTGEIHARDGHIYNAAFDTIDGHLTGAEDSLRIDSLVWKNGEGSHHIKGTVGLET
PHELNLRIESEKIRIESILKMAGMSYPVTGWVENTVNVTGTSEKPSVSGDFLAWDGSVAGQLFQSVSGKYSYDDGKITIQ
DGLAYIYDGTALINGSIIGDTLNMDVTLTDIDVGELLPDKGFNGKATLKGHVSGTTDNPAFTGMAQSREIQIGKGRLGSL
SAGIQYENHILSVSDGDFHQGGGAFNWKGLYNEESGIIAGDLEFHDWDISEVVRFLGLPISNISGTVNGGMSLNGTMEDP
NITFRAKVNGGQLANAVLGEGDIDFSYINHALSIRKLYIPVGEGILAAQGGMSSNGDFDIQAAASNMDISWIPRVTGKEN
ITLDGKMTAAVDLKGTKENPQIDFSVGVDHPVYNGYAFDDISFMGNTEGDVIYISQALARRNPYKASMKGSIPVNVLTRV
PSANAAPLDLDINLDHADMNALALFFNPVTSAEGPIKGYVKVSGAWDDPELRGDVSVKNGRIELLTLHDPIFPLNMDVKF
DGKSATVEGNAVFGTGKSSVKGGLEWDRGAIIAYNGEAHLHAPDIHSDYYKGSLDADFGLGEVMDVPGIEGNIHVHDALV
EFPLTLLSDSGSSSIPALIKLEVLVGDNVRAKSSSLYDLRLTGNIEAEGPVSAPAVIGKVNVEKGTVKVNMTEFNISSGY
AAWNGEQGNILPAIHMKGTTKVGSYNITAEMDGIPGNLKTEFHSEPYLNDSQILMLLTLHANPEGDNTEAIKGALFNAGL
TMVLGNSVQDFFKETIGLDMISITSSLTDYYDSRTVNNDNYYYIKIGKYLFNNFMLTATTGVNNNQTSIGFHYDLNSHIG
ISSWYNNEHDSYIGTDWKFKF