TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9LS91|C9LS91_9FIRM Outer membrane autotransporter barrel domain protein OS=Selenomonas sputigena ATCC 35185 GN=Selsp_1832 PE=4 SV=1
MRKKARLKQLTLGIAAALLAGSWQVPAWAAEQGPIKEDTTLTADTEVKADKNTIKWNIVNGASAVYANSSLTLDMAGHDL
KLDIRNLKNENNRASGLHIRPNATLTVHSDKNNASAANRLITINAHGNWKDADQHGGATSGIRFDEYAKKPMKADIHADV
QINELWAGREFARGIWAPGKATLNLDGTFTIKPGAVYHYWTEAGLGNVKSPSTYGIHVTGESNTLNIRRVDIDDPKIQRG
IQFGDEFNSAKDSVLRIGGGKLKIADNKARDQWLMWVKGSSKTYFNVNEAGTDAADQKTELAGPIHTENGGEVYLGLNGA
DSKWLGGTEAGATGKTTLFLKNGATWDTMNGGRGTRLARLSSTNGNEGNIFQNDAGKLTIDDYAGRQKIYYSHTGGDGTD
TSHYTAGDTHIKKAAANSFVTMVTDRTNPAANEEQIHKTLNALAGKLYYDAAKSGEDHLTGRAMLAEGLTASSAEVKVER
MKFSATTGQGSTDGTPAAPLPPVTPPGTTPGQPSTPPASAVLDTTQQIAEVGFDSMDLSEKWKNDGYGDDNGHYTFDKDV
IIRTKASDNKVIPAQRYYTGGIVVDEEAPEGPVTVDMKAHRLTLNSTADSDERYASGIVATAGNLEIKRAGGIDINITGS
KRSEHGIYAMATSRRDGRIVIENDDTAPHAVKIRNTSSGEKGNAITAKGASSRSALVDIKGLVDIEQDKENLLYASNDGE
IRIGGGRMMAGANAKAVHITRQGKVFINARSAGDGVDAASTERDVKVEGNVLLEGNGGVFGAALNTEQSYIKGKIGSSGS
GSTRLLLANGARWDNQSVGIGGDTIGRSHLTHLKSDGGAIHQNDTQDLTIDKFEGKAKLFYKHESDGTDTAHYKAGDTHI
KSAAENAEITVATDADRVNLSDDAAVHKTLNALAGKLYYDAAATERHLKGKAMIAEGLTASSASKKLEDITFKANGQGSV
KEDIGEGRQIAEGDWKGAVREQKYWDKKGVRSGSTYSFSNDAAFSPKLSDNPVKALNEYSRYDFGGILWGKGKNGSIHMN
GHALNIDTGVGNVRTQSGERRGDESTGILVNGGTLELKSLGKTTIQAHNNGIHLVGDQRKGNANLYIKNQADADHAVKIM
SKDKGIYLESYNGAARLEIDGMVDIDAPKGVVVDGGTLTIGGGRIVSKGDAALYVNSPGTAKINATMDGEGNVVPMHENR
DVQIEGDIQVKAGSASAYIGLTTKNSILKGLFTTDMYTWPQNNWELASGNGYLVLKNGGTWEHTKFGTGRDKNGTAELGD
SRVSRLNADGGIIRQKDKRNILIDDFRGNMKVMYEHENDGSKAADYKAGDVKIAAAKQGSEVTMVTDSKNITTSDEAQVR
SVLDALAGKLYYDGARSGLRNLKGKAMIAEGLTASSISKRLADISFRSDSGQGYTNDTIENGNYKNFHGLNTGIDRNDYK
PLTFDNFSGSARLYYKHVNDGTQTEDYGSDPAHKDPNKFYGDTHIKHAAANSSVTMVTDSNGVNLGDETAVRKTLNALAG
KLYYDGYVNGERNLKGKAMIAEGLTGSAVSQQMDLDYWLSNGRAHVKPKDTTPLTGETIKKQIAEGNFDTNDTKAYWKGK
GVYDGKGNYTFHRDIKLEVKAADKPVTSARDNKFGTIYWNGDVEGSIDMTGHRLDIKAGPGGHGLLPNEGPQAGWERTPN
AITVYSGTLTIKNVKGMNIESDPKGSLYGRGIFVMGYPGGPGHMSGHGKAKLVIENDDKMENAVKIRVKNTGEDFGAIEA
RKNMGSAEVDIKGLVDIDSTMWRAIESHGARISIGGGIIKGTDVASIAAYDRGTVFVNSKFDGNGNVVATSNTRPVQITG
DISSEGDGHIVLGLNNKNSFFKGMVSTDINGIDKQTQKWRYNPGNVSMLLANGAIWEHKQVGTGYHHKKETGSREKGIAM
DSRVTRLQADKGILKQNDPHKITIDNYSGNMQLVYQHEGDGTKAEHYKAGDVHIKKAAENSSVTMVTDSNGLTLTDETQV
YKTLNALAGKLYYDGYKTGERNLKGEAMISEGLVASSKTLKKANMDWSEASGQGSVKAPQPQPKPEPQPQPEPQPQPQPQ
PQPKPEPQPKPEPQPQPQPKPQPKPEPQPKPEPKPQPKPKIEYGDYETKLMSGVKSAMTASTMAWRAEANDLMKRMGDLR
LSPEDEGVWARVYRGKSSSDKDKTNFEMNYTTIQVGYDKKVGDDWRVGVAGSYMKGTSSFAKGNGENKEGNLGIYGTWSG
KNGEYVDLIAKIGRLSNEYTVYNDFNHYVKGDFHTWGGSLSAEYGRRINLNGGSFVEPQIELIYSHLNGVNYTGDTDYAG
QKMYVRQGAMNSFVGRIGLGFGQETKSSTWFLKASLYHEFAGDLSTDYSDGTNPWKTTHQEGKDTWLGLQLGGTMKLSDK
TSLYGTFEKTFGGDIKTDWRVDAGLRWSF