TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9RIK4|C9RIK4_FIBSS Putative uncharacterized protein OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=Fisuc_1885 PE=4 SV=1
MKKILLSIALAAISAFAVSAPKTHDGFFLNATMGAGYSSFEDKIAGGLGKMTCDGGAFEASFKLGGAITQNLILHAMFSG
DVIYSDLKLKSAYVDETLEHDGFNMLMLGAGITYYLPIQENVYVSASFGVTDISITLNNSDYSFDNLDAGFGFNISVGKE
WWMNDELGLGVAFSYTHHSADGNYRGEKNEATSNSFALVASLTFN