TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9RKW7|C9RKW7_FIBSS Uncharacterized protein OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=Fisuc_2329 PE=4 SV=1
MLKKIILAAMAMAIAVYAQANIKIGAHAAGSAGTVWGDNTDLLEVGWGPGFNVGADAKFVFNPAFSLLTGIEFDYRRVSW
DFGGFMKKIASPFMTSEYGYSSKYDQMMNLMFNMNITFSFLYVEVPVIARFNPAPNFYVDAGVVVGVNVISSATMKVDTF
GLEDTEDVPDEAKNAADISAIAGVGYSVTENIDINFRAVFGFTDMIDFKKFSDSVDSETKESTTSSMGLNSSNSSYSADI
GFKNMRFMLGATFWFI