TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9RM50|C9RM50_FIBSS Putative uncharacterized protein OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) GN=Fisuc_0600 PE=4 SV=1
MNTIKLTAMAFGLAVANVFAQSATEATTTEQKGPEFNISGKAEFDAYANAQTGDNQKINHSYASTIDVDFNVKFNKNWSA
FAEIEADGDDEAPLVTYKKAYVQYNRGDNFTLRVGVYNYDDAGIYAAGMREHDIRGLDLQLYGLQFGVGFGRGNNDVSCL
NSESFPCDYGESKSYDVHLAYQFDIAGQTFRPFVHYKSWQIKDANELHAGLHTDLLLGPFDIHAVYGLHADRLKKSYPNA
THALLAEPTLNLGRVFIKTGIFFAFFDDDMDKATIHETSATYYEIPEYKFAYGEVDFKALDVFTVGLIGEWHTNTLDNSK
ELGSVNFGTRLYFNPVKNLDMTGFVKAIIPVGDDWKKDGHEKWVSTNDYNNDVTFNIGLETVFKF