TCDB is operated by the Saier Lab Bioinformatics Group
>tr|C9XJX0|C9XJX0_CLODC ABC transporter, ATP-binding protein OS=Clostridium difficile (strain CD196) GN=CD196_1969 PE=3 SV=1
MFDICYILYITNIKTIIWREIMLKVINVSKSYKNKKVVSSVSFDVNDGELFGFIGHNGAGKTTTIKAIVGIHDFEEGEVL
INSKSIKKQPVECKKEMAYIPDNPDLYESLTGIQYLNFIADIFEVAKDKREELIKYYSNKFELNKALGDLISSYSHGMKQ
KLAIISALIHSPKILILDEPFVGLDPKASFILKEIMREFCDKGGCIFFSTHVLEVAEKICDKIAIIKDGNIIAYGTTEEV
KGSNSLESIFMELIEK