TCDB is operated by the Saier Lab Bioinformatics Group
>CEL94374.1 unnamed protein product [Vitrella brassicaformis CCMP3155]
MGIGTVTSTLSLMRMLTTASRFLGALFPVLILTCSLLATLPSLPSLLTFLTALLTINLSLLLPPSRHWTASVAALAVSSC
IVLAKVIACGAIGATGEGAGPEWVKTIGIGPFPSTSEVLAVVRFVVPDAIFLILSVCWVCVVVVRRRRAARSMTMRSEGD
SSYTSFTALQPQAASQLSVTKRFVVMVILYVYIVLSPNVLALPYALTVLIVLVRTAFAYKDPFPLTPMAYALHGCSNAVI
VLHFLCTFSFVSPSLTPSVASFIGVFPSAEAMVLSSTPAASGEALTEQRDAGLFVFGQYCVNLLLVVLLSHWLPAMKERT
SERQEDEDEDEEEEESNDDANGGDEATENGNEPPAAAAAAAASGGGGYQWATSAGSGMMTFSDRTVTAGDLASVVLGHHE
ARSVFGRLLHWVFFAVLTNYTGLLFVASLLVWSLLYPSLMSFVLLATAFAALLMIEAFGITSNKYTVKPVFIYATLFYMT
QYLFNVRGPWLDASSSKPSNIPLTYTAIEKVGLWDLLNLPSSPAASAGNSADSGLPPLASASDSAWGRLWILAITLVLLS
CLAVVGWVQSVRKEGEEQQQQQQGQQQQQREGGEEGSRHETERDLEQGMPSYLPQQSMDESEISSTLFPASEPGTVPPHI
EVQVSPPSTLPHISASLPPSGFKAQHYAERGEIGQHGAVPDSYNENDQPDRDDDSSPQFQHRSITQRLDARASAWKETLR
KGWGWVKKGVSRLFLLFVLYSDKVTVLVILLILFPLLSRSHTGGDATPVRHTSLIRVGYLLWFYLLLFFRKYPRPIWRGL
LCYCQAVICALFLWQVLSRGDSRYVWIGLVRSDRIDLFASLAYALILLACSQIQILLFLSKSYKLAVQMAEGTADGAGGA
TATPPDTQPQPQPQPQQQPSEPDDNLTTPATNQQQQEIVAAAAAAAVAPSRSTAGGGGGSVASSRRSTANESVLTHAAAT
LDTGQKLWVLQLYDRIGIWVVFALTLTVVLLPPASLDSFFFLVVLVAGVALLQTSGYKYLHIAWWIQATFAAAIVLFRYV
VLLKPVYEAIESEYKAAAGRGGWVFTLEEWGISIEDNHLLKLFFEAILLGLTVYQISLEYEIQTEERRAARTQQQQRQRQ
QRQAAHEISLTGRSVGVGMMSTIVEERESYLGDTTATQLITGPPNGDSDAATAPSTQVTEPSPPTMPRTKQQDEPTSVSM
RQPLLPLQAVAPPPPPAPPARAPDLVLPPPPPQPPAAAAVAVAVTGGIDMVLPSVPVPLHEWVDERMRDLSRHAAKVLML
VVFLCSLDVHFLNLVTVLVLFSLICAGRGWKHAGVFFSFTSMFILIAQYACRFDVAQTHLGDDKIAYWGFAWTGVRGAET
AFPSWTRNLLIILCAIIQRSLHFHFPYTRKEGPLSQFFTYYGVQIGLSVLLLVGLFRVNALAVVYALFACVFVWGAKPYR
TKWAVMAWLQVAAVILSLSILYQYIWRLWLPPGLHIGRVRRVDFRALCHALKYNQQHLDSCEEDWMSWLEIPQRSSGVME
GPVEIAVAVPEFLALMVCGIIMRATRRTPLILPATRPPPPSPPEHSYSPSRAAHTTPALSSSLFYFFYLCPCVLWLLLLV
NATVNLGVISIAYTVLLCVSLLQVDAPLRKERVRLTAIRSINVFVVLLLTVYQAPFFPCPYATDETPNALDKLPIGTFLS
RPQQSRRAPRAAADEDENEPEGTAWLGHENCQRLQSLVNEPHRSKDEWYTTGLQVLGVLKLEGLSFRDGVFLWNLLLFIV
AMIQYNVLYHPGYETGMVAFIRQEAKLRAVRAKRFIEMFHVKRILRCRQQEIVKAVLIDRLQRVTAHLARLQQIWRREAE
PITEEEETERQKVILVENISLKGYAPALSAEALERFGYIEPLALECLQMLEQHQLGLITEQEALRREQDLIRRAKERGAT
SDYLDIAELSIESAMSKLTQGSPPTSPVVQQMAAEGEGQGEGERDEAKEGIIRKMESEPAVVSPESGGSGQPMPMVPVSA
SSLSMPAGRGPGSHMGMAMTMVELLRERTSQVRLRRQRERHLRLRRHGEGEEVPHTMMPHPLPLPLPRPHTPAATPTPLN
IDKRRPSAGGTAMQRPPVPIGEVDESDEHEDLDLWYEVGGGWDYNSPLQAARDAVRAVSRYSAFGQLDSPSGPGPSPPSP
SSPPAPPAHEGNALAVSGSSVPQLPQSLEPSTPPPGATSSDTLRLRRAEGEREGEGEDTEDHHRQQQQQQQAPCRNSGGL
FGWLFPTIGSSNRQTQQQQQQRRKPHSSKRRRVVILEWLSWLDKRIKQAMQTRIVDTAFVQSMREPLPKHREGNGAFMLV
WKALFSYTLFYVAVAAALQFANGRTVLSALSGLAIICYGLIVYPMAAHGFWVGMIGYTLAIVLLKTCYQLSFFCAELVFD
LPCQAPLNVTWDVIIGVYKVRGLSSLREVSLFNAVWADYLLLATLCLHFMFLRKTGLWQYSEVDRGLQYKPPSVQVVPSL
QQRRERGVHHHHRVGVHRRRRDRERDRERNRGRERRRERERERREKQREDGMDVWSDDNVLSGVEMPADDSSFPMVTFAL
SPRSPGSPPLLPLPSLPPHPTSSSIVSSISHPPGESMPIIPAMPMLPRDTDKTSSSRLTTAPSEPRVPRYMSDPEISKAT
KRRRGRGRWGVRGGGRGGAAGGGRERKRRDERRAGGGGASGAKEGTPAGGDGQQRGLTLMSLWNRSIMGGGKVKKPGVDL
YPWMFTFSLCQLLIVLISYSVIWGAGETLTESLRRNQFGQGMVLVMIVHIAIIIIDRMFYRLSFKEIDSSLPPRQRRVYK
TVKAAKVILLIAEVLAIHILFIHRMAQPDQDVTDLEIGMWGNPAMLIYYFLIYAYFVLLARQIHHDLPASTGGHNLTSST
HLFNRTVYRVYRSIPLLEEIRILLDWTVAKTSLDTFMWFKLEDAYSSLYFVKGDMTVRKMYYPAEHRWLSEKIGLGLCGI
VGLVLLLLAPILLFSSFNPVRISNRVDDATSTVSLRVESSTDTLVVPLYEASSAVTIRDFSKCEIRRYLRSFPLTESNAD
IQSVVFPEASTTPFLVSPALIQATVDALSEPRSAQLELSYELKGRNTKTFVEGGQTTDVLRFADQLKALLNGTRTELTVD
RFYNPYAELGETGVSSIHGERRNATLFLLTSNDTFSGSQQHYWIINGTNTRSSASRGQSDKCPDTSDPRGRFTLVVVSPP
VLPFSSGSAQGGGGGQNLSVVGLYITVVLAIGRFLRLMCQGASQRVIYEEMPNVDLFVDICNGVYTARLRGDLVKEYKLY
FTLIKLYRSPELLLQVSGGELHGHRPYPPGAPKVE