TCDB is operated by the Saier Lab Bioinformatics Group
>CRH77963.1 Late Protein L2 [Chlamydia trachomatis]
MYTRSGIRIGGRVHFFTDISSIPTEEAIELQPLGRSQSFPTVSDTSDLYDIYADENLLNNDISFTDTHVSLQNSTKVVNT
AVPLATVPDIYAQTGPDISFPTIPIHIPYIPVSPSISPQSVSIHGTDFYLHPSLWHLGKRRKRFSYFFTDNYVAA