TCDB is operated by the Saier Lab Bioinformatics Group
>CUG89832.1 membrane-associated protein, putative [Bodo saltans]
MLNVHSVVLTFLLATCAALTGSLPSQPFMAYMLLLRTPDGPVVKWALWSMIAVHAVLPLVSLLLNLAATTDDDIKTKMFQ
NETTTFNAMRIAGIYSATAGSDLKFAASIVPEVLTALFAFIARRPLSQRPRPGAARNAAQKYSIYWALLLWATMCGAAAL
FVCSVVGGVFYVFAVVISSSMVFIGTEFTSHSTVTTLGVIGTIVGTLVISVWGVVQNYGAWQYFDGAFSDTVGLKVFCNF
VELKDGRCIVQFYLGLIATVCAHVMTHIAVYIGDAKPRGGGAKPLSQSTKQAGRVPHHQHSQQSQQLPLSQRLTRLSATN
TGPATATAAEDAMSSKGSIKSSGSKYFAILWSSRMDDASFSFIWGLIATVCALKDGRCIVQFYLGLIATICAHVMTHIAV
YIGDAKPRGGAKPLSQSTKQAGRAPHHQHSQQSQQLPLSQRLLENTATRLSATNTGPATATAAEDAMSSKGSIKSPSIKS
SLFLGTFLGTADVVAAIMRLFRFLATWIMMNFIVLPLFPLMCLVADLIIFPTIPTLALLPLVFCGLLKPSLMHAVMPYHI
ALMALLFMSQYFIYASADRGVSTLTKLFLRETTTGWQLLEIGINLAAYAVLLATYEQQKRFGSKGARRERKQKALEHQRK
EEAHLMKECVEHRLQVATITTTPTPTPANRPRSDSMRSDTFSTRGSNTITMTSATRESAARFIQQQEEREEQHRSQSRLG
MGEQHASSFEVEIEDDETLIERSVVLLGEERVRRIQQLLSERPGSTRDTQCFHRLTGRLPTDEELQALRRSSAMEVGSNP
NLLHDGEIVTGPPEDPIRCILRRRRVQAALPMWRQLIHDLSILINHYSLNECLRQVEAAPFDTRPLPALSTVTEPQQTLH
DGQVVEASCRRWFLVCYISALTLFEVIFTFVNRFLDTNGEEYLAPGIHAHTIGLVEMPSRWTAICYFTVLFFVCGQYHLL
KVSSISWDETVYVVRVAAPDQRPCRATHSTEINIGSGRRGEASPKLLWKLWLAASIYSGLVMLFVSLYQFRDIATRVNEG
LRSIKGCDVNLTITDVTTCQQEIGIVAPSGYVLTYFLAPWFVALVTAVAHMSSVSRTAAAATRDEARQRLRQENNLSQRH
ITGPAASTTRPSVTSETSRLLMTRAGSAGTPAEMLPLKNTDQDNDDDVSYALDGSDEGGGADDPTGMLAAARRFAAPDQL
MFHFIVWVVNGIEVLSDILAWIGHEYGALLVWGALYIAATTEYTLMAAVYAVFLVFDWSSVASLIYCVLHLTALYAYQFS
FTPTINVASGNVNWAELIGLIKNDSPEMNAVGPVLVFFAVLYRFKTSNTPAFTSSIGVAASAPSASTGNVLMHAKVKAWL
SFFHHQGFHLIGYEMLVMFSLLNVQESIQNACGSLAGIILVILMWAGRSQFFNSRLLSFVLRVLFFFLCAMQLLVRLNAA
HNMWTVPPTLVYKYFAWERTSPTSQWEHWAGTGSVLGMFIPSLPWVVLHMLRNKQAQTQAHYNNVNHTNDDNNHERVELW
VQRNLYFDARSFTWYLSDLFSDPDKNRVLLADGLNQRQPSKKREGNVLRNLSTEKLNHYVPEIPNSLDVNTGLPIVQRAA
GSPQQQQQTQQSPPKPGSDLHSQPTSTPIASNLGRRGGNAGDINGSVMDLRRLNNSNSSATPPTSHFTCISPPPRHLLFY
DALMTFVVRANSFLSPVAIFSFAAGTMLPSILCTLLMVAGMMQFAYRDQLNWKFYRLWPKILLAYIAALIVMPMAMNVPV
VGNWATDKMNNIASIIGLLENGVPTGISGMRAALLFMIAFQTRIYEEFWFERMIRAMRSDLEKRCHKHTELMRHIADSQR
KDVENADVRDKQLRDRLRRVREMYGGIQFETASPCGGEDDPLPAAAAAAAVAPSTIPLWLPHQALFEVVSTEEEERHVRH
PQERVVAEQRS