TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D0LVA6|D0LVA6_HALO1 Uncharacterized protein OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=Hoch_4978 PE=4 SV=1
MSKRLGIIVLAGAAIIALPTAAIGDVEHELHIGAQSGAVWSELFRSEPISSPNEATYNRRFFGGLALRLNTNAWDWLSLG
AQLELQYDRKGARIESGGVRVGDRYLNYLDVPLLVRATFSPSRYAKPYFAAGPRLGVLVGAEREDFNGNIQDQSDFYDSV
DFGVHVALGVGVQLNERLTVEIEGRYDVGLSDVDSASAQPGLRNRSFFLVLGVDYELWRSGGSGEPPR