TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1AA09|D1AA09_THECD Uncharacterized protein OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=Tcur_1363 PE=4 SV=1
MRNFTESMKVLQIFSLVAAATTMGLAAGLFTSFSYAVMPGLARTGDRVFIDAMQRINTAILNGWFALVFAGAIVFTGLAV
GVHLGGDHRAMLPWLVAAFALYAAVLVITFTVNVPLNDALAAAGDAGGLADPAAVRAEFEGRWVSWNVVRSVLSTAALVC
LVWALIRSGRAL