TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1PQ73|D1PQ73_9FIRM Uncharacterized protein OS=Subdoligranulum variabile DSM 15176 GN=SUBVAR_06541 PE=4 SV=1
MSLYIVVWGILCLFTVKGAVARESRTARQLAFWFCFLLLAAMLVLRFGQGTDYFSYLDYYYRMPDTGIHVPVPDVHGEIG
YQFLTNVFRLLHLPFEAWVALLSVIQMACLLRFLRLYHIDCVLSLLLAVPTLYLTYFVSGLRQGVAVAVFLGILFPLLEK
KNYLGFVAGTVLCMLFHGASVAFLAALVAQKIRKISSLQIFTVVAWAAGLFLASPPVQSLIAASDSWAIRYYLQDADMNP
AAAAERLLFLVLVTWLYEKLRRLGKTGPVFLLAYRCYLMAMALYGLLICNGTTASRMASMMRYVEIYLLAWALGQMTRFS
RYLLTLVLVALQTFMLCKNIQTAIDQGGYRSSVTIRNFPYVSVFNEEEIFAVREIAPELLDHPECRILYARKDIHQL