TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2CZG7|D2CZG7_CAPAN Cytoplasmic male sterility-associated protein OS=Capsicum annuum GN=orf168 PE=2 SV=1
MPKSPMYFWLNKPAISDKSFFIGRARSGTTTFTCNFTMNFIDYGTLFTFSFYLGISIGIFAGRFFERSEVLQELENFQLE
KIKLKTEAELQFLCREHLRMNEELQLPVPDGTSMHISDFLGKAFLVDETVRERILGLTQIYMDLKNNGATSNFFLLFLDY
YSNLFSAF