TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2QF92|D2QF92_SPILD Uncharacterized protein OS=Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896) GN=Slin_0505 PE=4 SV=1
MKKILLFASLALLPALSFAQGGFQIGIKGGVNLSKLSFGNFIRTGTSGTGSPTVNIDGQTFRNNLSDSFDSKTGTSFGIY
TRFGKNLFIQPELLYSTRSGQFGVIRNGQTETVTVKTTSFDVPLLLGIKGGPIRVMAGPVVSFRIDDNQKLGQALSQYTS
GSLNDAWSKAYYGYQVGGGLDLGSLGIDVRYEGNLSDIAQIEDSQGKFSQRLKSWQITLAYKLF