TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3L749|D3L749_OENOE Putative uncharacterized protein OS=Oenococcus oeni AWRIB429 GN=AWRIB429_0179 PE=4 SV=1
MYKLSIGIFALTGTFGISAQAAKMIYPVIYAAFARGSLSIGRSIALIAATGAGCLIAAAVIGAGGIFISRKLKAGRGATL
AW