TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3PJ72|D3PJ72_9MAXI Lipoma HMGIC fusion partner-like 2 protein OS=Lepeophtheirus salmonis GN=LHPL2 PE=2 SV=1
MCKIIVTVRTVLWYVMSLAGTLMILVSLFTNKWLLGKISTTNLSTSDDFLSTAIGLGNSVASGNIKDILERNVGLFIDCK
IPKGKKFFEGECIPDWENIDKVFLDMSESAYPHAWRGAIICFVIGLAFMIITDFFALMTICCRSCVCCSVFTICGSIQTF
ASILFILGLVAYPAGWGSAKVSNSYCGGQSEPFFLGPDCKIGSAFWLAVAGTVCCFLSSSLAIWAYRSTKTLKCVDRENQ
GDHCICLP