TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3R799|D3R799_BIFAB Raffinose-binding protein OS=Bifidobacterium animalis subsp. lactis (strain BB-12) OX=552531 GN=BIF_01592 PE=4 SV=1
MEMDKGVRMKFATRMRRSAMRRMLRGIGAAVCALAVGVGAAGCGNSAGSGQVTLDFFQFKAEAADWFKQAAQEFEKENPD
IRININNSANAQTDLRTRFVKDRVPDVITFNGDYSFGTFAASGVFHDFTDDPLVSELNEGMVNIAKNLVQTSDPAKKRLY
GLPFAGNASGYIYNKDLFRKVGLDPDNPPQTWDEFIAMLKKFRDAGINPVQATLADAWTTQAPLASLAGTLVPESEYAAL
KSGDTTFKQIWTEPIEKEIELFKYADSEKGVTYQQGTQNFAKGTAAIIPLGTYAIPQITMVNKDIDLGFAQMPATNDASK
QILTAGDDVILTMGANSRHKEQSMRFIRFLMSKKQLENYADAQSAITPLKETYFGNKALEPVRPFFESNRVADFCDHYIP
SSINIGGYLQSAIMSGNVNQFIDSMQNEWNKVQARDFRK