TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D4JEY0|D4JEY0_9FIRM Ethanolamine utilization protein OS=Eubacterium cylindroides T2-87 GN=EC1_13310 PE=4 SV=1
MNPFVCIMLIFATIGLIDKILDNKFGLASAFDKGIITMGDFMLSISGFYCISIAFLRNNTEILNHLGDFLFFDPSILIGS
LLAPDLGGYSIVEMISKDPNMIVFAGVLLTSTIGATISFQLPIFLNNLEKDDVPSFMQGIAYGLIVLPIVLILVGLFLQI
DSLMINMIPLLVLCIFLLFMFFINLKLSVKILTIFANMIRILGYLFFFLVCLTFFFDLGFTQQDLIQEVFSIVFQMTLIV
AGSLVLCQLILKYFSLQIEKLATMLHINQYALIGLILSLGTSIAMMPLFSKMDTKGKLINAAFSASGAYVFGGQLGFIAS
VSNSFSTTIFIIAKLSAGILAILMVYLFTKRRMEN