TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5FGJ2|D5FGJ2_9ALVE Natural resistance-associated macrophage protein isotype III OS=Perkinsus marinus GN=Nramp PE=2 SV=1
MGSSEPYEPLLLPTATASTASSGDDEDIARGRVVVCPVDSLPDDLSEKRRTKFSMRTFFRYAGPGWLMSLAYLDPGNLEA
DLQSGVYTGFQLSWVMLLAHAVGLLLQCLSARLGFVTGKSLAQHCRQGYGQRTGTILWILTEIAIIGSDIQEVLGSAVAF
RLLFGIPLWMGCVITAADTFTFLAAQYLHGTRVLEGLVVSVIMIMCACFFANLDIVKPEPINVALGFLPSVASYAVVQMV
GVVGAVIMPHNIYLHSALISSTRRIDRRNPRALEQANVYFSLDAAAALAISFFINTAIMTSFAQGFFSPHCATNPSGTLG
CNTAAVVPTSECELAVCSCVNSMGQEGFCTAIGLSSGGSALASLVGSSEFAATLFAIGVLAAGQASTMTGSLAGQYVMEG
FLGLRIPLWLRLLVTRSIALVPALFVPVWQSSAAGESAASLSAVNDWLNILQSVQLPFALLPLLHFVGDPKVMGHDWVIG
RRLKIICWACAISLIVINAYLLHSQLANIQAGTFVLVLGVAVFCGYLVLMATAVQSELKAFLRYIRSPWILWRATNYRR