TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5QHE9|D5QHE9_KOMHA Putative integral membrane protein OS=Gluconacetobacter hansenii ATCC 23769 GN=GXY_12083 PE=4 SV=1
MDAKSGNNRPCFPDGRHAGYAFARPIVFQTGGVMSHSILWSLVLAVHLLGMAAWVGGMIYAVFVLRPSLGLLDAIPRASV
HLQTLNRFFRIVWHVMPMVLVTGWLMILHEGGFAAIAWQINLMQLLGLMMALIFARIYFGPYQKARRAMRPQPAMFDSIR
SQILINIGLGVLTIITASLAHPF