TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5RQT3|D5RQT3_9PROT Copper resistance protein D OS=Roseomonas cervicalis ATCC 49957 GN=HMPREF0731_3445 PE=4 SV=1
MILELLRAEPDPLRALSVALRLAYYVSCLGAVGLAIFAMGFGRLQEAGDVAACRRLTLVMVAAGLGSSLAWLAAQVALAS
DGDPFDAEVWDMMLGSRPGASVLVTWAGLLAVALATWMGRAALVLGAAGVLAVAVSFTEVGHTTQHQPRWLLATALVVHL
LAAAFWAGSLWPLLIASRRAGPRAASMVEGWARAASWIVGGLVVAGVTLAWLLVGQLELLVTTAYGWVLLTKVALVCVLL
GFAAWHRFRLTPALAAGAPGSGTRLAASIGWEIVVMLLVFWAVAEMTSTSPRPEGM