TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5UQW2|D5UQW2_TSUPD Putative uncharacterized protein OS=Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / JCM 10117 / NBRC 16120 / NCTC 13040) GN=Tpau_0299 PE=4 SV=1
MTKKSNYRPIMVAHPLGRRSLSAAIATGILLVATPLQVQASPVSPSNERAGAVQERMVTKTTPTGVVMKVGLRSPRVESY
PPLDSSPFSREAFLSMRGSAILTGQKDAIKSSRTKLDMGYQIGYPMSVAKDGAKIGIVTPNLTVNAGVKPEAGVGANAGV
TPKFGVNGSATGGGGTSGGNGSGTVGGNVGADVPLGVNASSKVGAELGVKSDIIPSQKIDFTIGHGEIKEISVAKFELKQ
DDAILDVDGTEISVTAMAGRVSIRPYVRASIETAKGISTTVVYGAVAYL