TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6TJP8|D6TJP8_9CHLR Uncharacterized protein OS=Ktedonobacter racemifer DSM 44963 GN=Krac_11220 PE=4 SV=1
MSKVEQKTQSMDPTHPWKLTTERIVIAAMLAGLTVCITLIPGIGFIPVPNVSGNATTGHIPTIIGGIVGGPIVGLLTGFI
FGLMSLLHASSPLFKDPTVAILPRIFIGLTAWATFAALKRFSFDVAAISAGVIGSLTNSVLVISMGMIRGYIPANGVILA
SFLPQVIAEAIISAIFAEAVARSYAIVQQRLVHAPETKAREELPY