TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6TJQ0|D6TJQ0_9CHLR ABC transporter related protein OS=Ktedonobacter racemifer DSM 44963 GN=Krac_11222 PE=4 SV=1
MLFELFELKDVRHTYLRDTPFATEALRGLSLTIPEHQITALVGPTRSGKSTVVDILAGLIKATPGTLFFQGEDVMAPSFD
RERLRTSVGVVFQSPESQIFEETVGKDVSFGPLRKGASFAESRRLVQTALEDVGLPYEDFRTRYTYALSGGEKRRVAIAG
VLALQPAVIIFDEPMAGLDPRGRRELLALIEHLKQTQQMTIIYASSSLEEVVGLADTIHVLERGQLAFSGAPREILARAN
ELVKLGIELPEAVRIALVLREHYPEFPTTVLTLDELEEAIVQHEELRIRSGRQQP