TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8MFQ0|D8MFQ0_LEUGT Substrate-specific component QueT (COG4708) of predicted queuosine-regulated ECF transporter OS=Leuconostoc gasicomitatum (strain DSM 15947 / CECT 5767 / JCM 12535 / LMG 18811 / TB1-10) GN=queT PE=4 SV=1
MQKNLVKTDKSIGSVQNITLIAVIAAVYATITFVIQPFAFGPVQLRASEGLNHLAAWHKRYIIALGLGVFIANLVSPLGW
IDWIFGTMGTVIMTSITYLATRRVKHAVTKIVISSVVVATIGMAILAAEFTLAFNIGASGAFPSGSNGGLFAQWLAYYLS
VMPGEVVSLIAGGIVIYALSKMVDLSK