TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8NKS4|D8NKS4_RALSL ATP synthase, protein I (Accesory subunit) OS=Ralstonia solanacearum CFBP2957 GN=atpI PE=4 SV=1
MQPAERQRPDSHVHASSEDARSTPEPAPKRDWDADDAGEAEPPVHALSHDEAVALFGEKALRASRVTPFSIVLGQVAITL
LCALGWYVGSWLAGTGAASAGEAALSALLGGGVCLVPSAWFALRLSTAKGFESIARLVVGEAIKVLGTVALLVVVVVTFK
GLHWVPLLITLILALKMYWVGLALR