TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8PAJ2|D8PAJ2_9BACT Putative uncharacterized protein OS=Candidatus Nitrospira defluvii GN=NIDE0476 PE=4 SV=1
MRRIRALLIGLTFLGIHWVAPTTAAEVQEPRWGFSTDLGLWSGTTNDTTFALGFGLDYYMDQNFSFGGMALFTPVGDLTQ
IGIAGVAKYHLRLNSGFNLVPFAGLGILHADLNRGNGPTKVDRNDTSHFIPLGMSLEYQVGPKIAFSTTLMVNLHHITLS
APVPDDNTSVALLFGIRWGP