TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8Q4J7|D8Q4J7_SCHCM Putative uncharacterized protein OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SCHCODRAFT_82248 PE=4 SV=1
MSSDTPTIDMTPQGLLNADGNYVLQQEDVYNLLKYVWAGVLLPVTPDDYQKRLQISTDIATKLSNVITPLVAAYKTCSAN
CTTFKTTTYPSIVAIASDIYSYAQNAGGTAQDSYYANIWQGIRSLANATSPTQAQQLTDTINGLIDVQVTDIANIKAKAE
QVVTDLTTFKTQTEGDQTTLKTNLDAVAAALKAEDGDLATLEKLLVDNKAELASDEEEYEHDVIVACTTLTYVWVPLWGT
ISAIVVAGVFGKKAADMADKIDEMKKLITDEEGKISDEKRLLADLNAVDTDLTNFYASIDPAVTALKDMITVWDNISAQL
TNLKSIVANDVKKANAVTAAQTDAILVAKWNTLKEAVDKYRKAAYITPIQQSSLDAISAQLRQQASRAA