TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D9WH14|D9WH14_9ACTN YhgE/Pip domain-containing protein OS=Streptomyces himastatinicus ATCC 53653 GN=SSOG_07208 PE=4 SV=1
MKEIHPFRVLRAKPLWIVNGVITGVLALLFTVFYVGANIDPVDHMKKLPVGLVNVDTGAAVGGKQVNLGARITESIKKST
TSGDKIDWRVMDEKEAKEELGEGKLYGALVVPDNFTSSVTALTGTAATKSPVRPTLKVLTNQSAGSLGSSLARTASTAAA
ESASLQVGKELTAQNGAGQAKLPAAARVLLADPAAVTVEDGHPLHSHSGLGLTAFYYALVLVVCGMLSANVISGQADHAL
GYTHNDMGPLRLHRPLIRATRVQTLAISSTLMIGLSLLMGTLVMVGAVGIMGMDASHLPLLWLYSVCAIAVSGIGALALL
AVFGTPGMLVVTLVFIGMAVPTAGATTPIEALPGFYRFLAEFEPLRQIADGVRSILYYDAQADAGLARGWVMMAAGLVVA
ALFGFGVTGWYDRKGLHRIPAEAKPDGIAVPV