TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E0ZN37|E0ZN37_BCHK9 Putative uncharacterized protein NS3 OS=Bat coronavirus HKU9-5-1 GN=NS3 PE=4 SV=1
MNLYRLVADALYATPAILTVDIQPTAEVVHGVKDYVHLTMTVALILYATVTLILWFLGGSKYPYLRVLSHIALCLLQAGV
LVWLSFSSNKIISICAQGIVVVCAFICVFERLAMAIKLRSLAPFTTTADYFAIVKTTCDTFVFPVDSSVENLVVLTTSRG
FYCNGNHIAGSIAVSDSVTIVSLFNKHLLLLDRVEHGYDYTVFIYVNSVILENTHPKVGVSNPEFDNVEL