TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1AW23|E1AW23_TACFU NaPi-IIb cotransporter protein OS=Tachysurus fulvidraco PE=2 SV=2
MKDRSASIPPAVSTVALIGDDVRTDEDVWDAVDLEDTGITWADLDSKGRVLHVLVSVVKLVLLLGLLYSFVCSLDVLSSA
FQLVGGKAAGDIFQENQVLSNPLAGLVIGVLVTLLVQSSSTSSSIVVSMVSSGLLQVSTAVPIIMGTNIGTSVTNTVVAM
TQAGDRNKFRRAFAGATVHDFFNWLSVLVLLPLEVATSYLYRLTELIVSSFHIESGENAPALLNVITDPLTHSIIQLDES
VISGIAVGDQDARNKSLIKTWCQTYTNTSLQNVSVVNCTANGTPCWEWKNISQTINIQKCGHIFVDTTLPHLAVGLILLA
GSLLVLCICLILIVKLLNSMLRGQVASIIKKIINTDFPFPFRWVTGYLAIMVGAVMTFIVQSSSVFTSAITPLVGLGVIS
IERAYPLSLGSNIGTTSTAILAALASPGETLTNSLQIAPVHLFFNISGIVLWYVLPFMRVPIRMAKSLGHVTAQYRWFAV
FYVLLCFFFIPLLVFGLSLAGLTALLTVLIPVAFIIVTVIVINFLQSHFSERLPSCLRSWDFLPLWARSLEPWDRIIMSM
SACCCCCCTKCCQVSAGDEETESGGRKIYGMEIHDNPALTNDSEETVKTPPTSVILNVTAL