TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1C3A0|E1C3A0_CHICK Uncharacterized protein OS=Gallus gallus PE=1 SV=2
MTVTYTNRVADARLGTFSQLLLQWKGSIYKLLYSEFLIFISLYFAISLVYRLILSESQRLMFEKLALYCNSYAELIPVSF
VLGFYVSLVVSRWWAQYESIPWPDRIMNLVSCNVDGEDEYGRLLRRTLMRYSNLCSVLILRSVSTAVYKRFPSMEHVVRA
GLMTPEEHKKFESLNSPHNKFWIPCVWFSNLAVKARNEGRIRDSVLLQGILNELNTLRSQCGRLYGYDWISIPLVYTQVV
TVAVYSFFLACLIGRQFLDPEKAYPGHELDLFVPVFTFLQFFFYAGWLKVAEQLINPFGEDDDDFETNWLIDRNLQVSLM
AVDEMHQDLPILEKDLYWNEPDPQPPYTAATAEYKRPSFLGSTFDISMQKEEMEFQPLEQIKENEEANHSTPLLGHLGRL
LGVQSPSFSRSSSRMNLLRRRGEPTSPFSHYTYQDMGKSGNISHPRKLREFDAFISTPFYERPGFYSAPQTPISSIPMIF
PSRRQGRKKPPALSSIAACSNSLKMSDTYKSQSSLGSGAKETFIWPTERNKGPDSLVVMVEEEKSNSSSKKSPDHEQQGS
FKSLKSLKGSHPPWLTLENAATTTSNCEQSSAFPQPGNIPPSSSTSFCFSFTPVASPVLERSPIEVSRSGRDTASRSSNA
PPTRETRRAESPSTNDSGISLAEGDYVGLMEVIMEASESVCEEQMDQCS