TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1L9D1|E1L9D1_9FIRM Putative uncharacterized protein OS=Veillonella atypica ACS-134-V-Col7a GN=HMPREF9684_0664 PE=4 SV=1
MKKLVLLSLAATVITGSAFAASVPVTKISDNSTKIQADYAFNQRVSNSGGTNNDGFGVSLEHDLSNKSALQYSYNKVNAK
NGDIKDHQLAYVYKVHPNVNIYGAGTAIRTHDTELGVQAGVIGHVPLTDKVNGFAKAGWGNDIKQSYQVGAQYEVKPNID
LNVYYGYDKYSVNDNDKTSKGLHAGVGYTF