TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1WEV2|E1WEV2_SALTS Hypothetical type-1 secretion protein OS=Salmonella typhimurium (strain SL1344) GN=siiF PE=4 SV=1
MDKKLEPYYLSAETALSIVSKKFNIKIDIKEDDINLRFKKYDRNNTDDSIQMKNFFLSLGLSLQDILFNNGEDLLNEPMP
ILLLTPEMKWMVCVSGGQKIKLVNARGELCYVEIEDEYLKELSAFSILPLNKVVDSIRVKNIIKNSLSMNKIFYTKYFFS
SLFMAIFALTIPVFSNLFYDKLVPSASVSSLFGVAIIVAVFIVFEFILRTSKDIYQSITARQDDVDIDIAFLEAVLYSKK
KNGRSMSSAFVLWNEFQKIKPVLLNSIFQRIADIPIFIIFLIVIYVNLGLVVIVPITMFIVSIIISLVNHHYTNELMNKQ
KEGQKNRNIFISEVFLSIKMIHTLNNQGLLFDWVNTSNEQSYLNLKIRKLNLIYQSILGSMSSITQITIMVIAFFMVIKG
DVTTGAIVSSVIVSGRISGIISNFSSTLISILSAEKTGKDLLSFFDEDQAEKTPALQSISKCNGDISIRGVSYQYDAQSP
MIINRLSIDIPAGQRVAVVGECGAGKSSLLGMLSGYLSPTDGAILYDGYNLGHLSQNFFSQHLSVVTTHDVLFTGTIESN
FALKPQNDRGRVLKALQLANCGFILQHPMGLKFPVNFMAKNLSSGQQQQLLLARSLSSDASVFLWDEPTSNLDENTEKQI
FDNLDEFIHGKTLIMVTHRRYLIKYFDRVLVMKGGKIIRDCSPDKLLM