TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1ZDI7|E1ZDI7_CHLVA Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_145022 PE=4 SV=1
MGWTGFLGLFLLGCSPLAAVGSVCIFPKSFLLLLALGSAFFWLLTLFLISALFRAWAPLPASPGPYAALVLVAVLVQELA
RVGIWRFHRQAAGSVLSVRVLQRIAAEQGDAPLSAADRASLALTHGLSHAAVHSAFFFLAWLPLSLGDGTIYSPHCPHMS
YFLVGALSTLGLAALLAGGMVLFFDGLERREVGRAAAVPMAHAAAALLTLLNLADGGCMVSMPLLLAGGGGVAAYAARVW
WQRTTSPSVPPRLLAARRAAAAGVALSGDAGGSILAGERERER