TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1ZJE6|E1ZJE6_CHLVA Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_135934 PE=4 SV=1
MARPAVPGHRAKLLVCVACTVLVWASSGLTTPTSAQASETEAQASATPTNPQAQASKTEAQASTTPTTPQAQATQTAATA
TAAPAIPKAPQTPPPPSASLATPALSQAATPAAAPAATPSVSALLRLARATAAAQCASDGGACTTDGQCCSALCSTSISK
CGCSDDGVPCTANRQCCGGLCNAATLTCGCSDGGGGCERNSDCCSGACSPAKTCGVGCGTGGAGCVENAECCGGFCNSQG
TCGCQTPGYGCEFDDDCCSANCDPGYGLCD