TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E2PBK0|E2PBK0_PASHA Putative outer membrane protein OS=Mannheimia haemolytica serotype A2 str. BOVINE GN=COK_2563 PE=4 SV=1
MYKKHFLFLLVSPLVMAETVEFQQDPKEFDGQRQAVKFEQEIAKKDLKLTAYLEEDNSLKGIEQHINQAILRQDWAKLER
LLGDYAKQEQFDPLLLDYALAALAYAKKDYRSAAFYYQQLLKKQPDLTYPRFDLALILKEDYRYREAEQEFKQLKTDDLR
NAVNSALAQIEEEESWKPDFYLQYTQTNNVNNASSSPTVNVNGRIFIKESDSLPQSAKGVRYGVGLSKMRNIGGNHFVGV
DLGYNGVYYWNNHDYSEQSVSLTPKYSYRTATYRIGVSPFIEQNWLGSSRYNYQFGSSINAVKLFERGLISGSFSHLQKR
YSEQHIADRYNGYRNQLTLGTQWQAVKNWRFFANLNASREITREKAQSSNKWLATIGVIYQTPSWASSVSVGYGKRYFAD
KHYLFGYKRQDKEYQANVAVWNRSWHWQGIVPKLNFRYQKIDSNIADFYSRSNKEVFMTLEKLF