TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E3GUW2|E3GUW2_HAEI2 Probable ABC transporter, periplasmic-binding protein OS=Haemophilus influenzae (strain R2846 / 12) GN=R2846_0996 PE=4 SV=1
MKLKSLLIAGLLGSLSFSALADRIITDQLDRKVTIPDHINRAVVLQHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRL
APELENMAMPGDLNSVNIESLLALKPDVVFVTNYAPSEMIKQISDVNIPVVAISLRTGEVGEKGKLNPTLTDEDKAYNDG
LKQGIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKYTGLMMEHAGAYNVAAATI
KGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANIQALKDKKVFLMPEYAKAWGYPMPEALALGEVWLAKALYP
QRFQDVDLDKMVNDYYQKFYRTSYKPDNAAK