TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E3HXW8|E3HXW8_ACHXA Cation efflux protein OS=Achromobacter xylosoxidans (strain A8) GN=AXYL_06637 PE=4 SV=1
MPENDKNDKDDELGGLDASNAADRKILRSVLLINLAQSAAGIGIGLWAASTALMGAGLDNLADASVYAVSLYAVGRAAMV
KVRAARLSGFLLIGLAVLLLVEVLRRFAGGEEPVGPAMMAMAAANAALNLVCLRLLRRHRGEDVNFKASAIFTSNDSIVN
GAVVLSGVLVMWLGSNIPDLVLGVIVAGIAANGGREILREASQTARRNASA