TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E3PBQ7|E3PBQ7_ECOH1 Putative polysaccharide biosynthesis protein OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=ETEC_2174 PE=4 SV=1
MRQHRKLVSYAVIITFLFIPIQVILSLIFNYYLAKNVALDVLNAWYMFFALISLFSLLEFSYPILAINFFNSYQGNCKGA
LSFFIKKSLGVVIPLQIIFVVIYSLFVNPLFIYFGMGLVVRSISNIINACVYAKQNIIIDKVYRFLYAIIMPTAFLFLFY
HSDKNIDLYDLTLVWFLSSLFCLIYSLSFLLLKHKKSVNRSEKSFHLPFKYNLKLFFTVFPAIFIYTLSIYYLKIFGSES
SSSSTIIYGFFLQIFNVYNLIIILVASYLMPTLSKRFHDGVDVIPLTLKLLDISVLISVISTSFVALLGIPVAEYILKGK
IDVISYYYIVAIIIIFYIETCQVILTSIGTAIGIYDFHRQSIISAVMVLILSCFLIPHYNAEGLMYSIIISQFFTCFIYN
PKRVINKIGLDKVNYIKRLMVHFLFMLTLIFMGLYFQNDDILPRVVILSFITLIGVCFLYPNVKKIIVDFL