TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4P9F4|E4P9F4_ECO8N Uncharacterized protein OS=Escherichia coli O83:H1 (strain NRG 857C / AIEC) GN=NRG857_03025 PE=4 SV=1
MTMEMILALGILVLMIVLIMSDKMPFGAPPLLACLLLVVSGLSTVQQAFAGFVNPSVVMIAGFMVVMAALQKTRLISNVK
SAMISLVNKGSYRSYGLLLVIVMLGASLAGTGATGYYVLILSLVSTIPYSKKLPTSKLMMPLGFATNHPLLPINLALLFG
VTATVLETAGFHQEISMGRFALVNLIMSAAFLAWSLIAYRFLPDHPIADASEDALAAREETFNALPAWKEYCTIAAFAVS
VIGMMLMNILGNIAFVIPGLAGAFVLMIDVLDFKEVRDHMGAPVILMMAGVIGVADALAGTGFTAMVGDAVAGVLGSGVS
PFVFIVAFALLTSTCATFTGSNMGSVYIFAPIAIAACTSLGLNPTAAAIAVVISGWNGGYMPIDGMPAMILGMGKYKLPE
FWVFSVPMYLIRILALCAGAVFIFPM