TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4T302|E4T302_PALPW Uncharacterized protein OS=Paludibacter propionicigenes (strain DSM 17365 / JCM 13257 / WB4) GN=Palpr_0946 PE=4 SV=1
MFKIRYILLFLIFLPVLTHAQNDTIKYNVGFMGVASSGKYAPFWLQSDQYGKISSSPFGVGVLAGVSKEFGAKKRLFDYR
FKANLMLQTDKGKATAFLHEYYVQARFSVFDLTLGAREEQLGSQDSALSCGGILFSKNARPMPKITLGIERFTVVPFTYA
LLEVKGAISHGWFTDDIYTTNLFLHHKYLYGRVGGELPVHIEYGVDHVAQWGGSVPGYGKQPSSIFDFKSIFLGHSGGAD
ATRNDQLNALGNHIISQHLKLELDIADFRVSGYWQNLAEDGPVKLMWYAMNKADGLWGVSVRNTEFPFIEGIVYEYLNTT
DQSGPYHDKDGLVYGGADDYLNNGIYQNGWTYYSRTISTPFLSSPLYNANGGVSIQNNRVIVHHFGIDGSVSGYSYKFLS
SFSKNYGTYSAPFATNGIKNTSCLLEVSKKYPRWANIELRCSAGADFGKLYGNSVGCLFSILKTGNLFKY