TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4T7X1|E4T7X1_PALPW Putative uncharacterized protein OS=Paludibacter propionicigenes (strain DSM 17365 / JCM 13257 / WB4) GN=Palpr_2685 PE=4 SV=1
MKKMFFALALVMSTVGTSFGQTNGQTLGLRLGYPTELSFQTGLTKSTRLELGLGIRDYSYGTNFSFSGVHQWVWDLSSLS
PGFNWYAGVGGQLGVYSNSNKSYYPLALLGQIGIEYNFRIPLTLSLDYRPAFQLTGIYGSENAFIGDGICLGLRYRL