TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4TBK6|E4TBK6_RIEAD Hemin receptor OS=Riemerella anatipestifer (strain ATCC 11845 / DSM 15868 / JCM 9532 / NCTC 11014) GN=Riean_0671 PE=4 SV=1
MNKKIFSILGLSVGALFYSQDVSVIRNTVDVYSDTQPNGSAKYMGMAGAMGAMGGDASSINVNPAGIAVNIVGEFSGTLN
ALGNKNTSTLANKSYDEVYKKANLGHLGGVVVMQTSNNSKWKFINLGFNYSAKDIDSYIRTPENHTINEAVNYTDEKGNK
QTDMLLYDGHAYNRVGHTSKLSFAFGGNYDHKWYVGGGVHFHSANIEQGDFFRMQSQTAGTKGLYQKQETPFQESSDGVA
ISAGVIGKIDKNFRVGLALESPTWWNIERAYNYYDIDNNGVVVTVLANENRRLSTPMKATLSGAYIANKNFAVNVDYTLG
VTKPQYNVQGEVEKQLNEFFSKVYSNTSELRLGAEYRLDNWRFRGGYAYQSNPFYSSSLSVIDPTSNLYSDRKFNNLYLS
NRQTFGMGLGYNFKSFYVDAAYQNTSSKFANPFYAGDYASPMENSVFKEGHIVDEQYDSIVSDVKTVRNNFVFTVGWRF