TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E5S3P2|E5S3P2_TRISP Uncharacterized protein OS=Trichinella spiralis GN=Tsp_03445 PE=4 SV=1
MFSPLFCLLLLLSYCVMRSVNLDTTEMTMTTTMQTQIGLHETGCFFVNLHPDNRLSLNDTVEESILTSNTSLLHTLRYES
THQLYPVRQQYIFAIPEIDSDCICDCPGGDDHCAVDYAYKNCTGDNHSAFCVHTYHPHQSAAGCQLAGEADICCKLVVKP
YQNRRYVAVQIGQPLTVATFHYQLYSKQHYDQWQMLHDQRFQAVSGQSQRVQLDQAGLQLQLGDLKPIWQLKEGMYVFDL
NDENFTLRHGVPINRFHEYSGHKLGWLRWQSADKRWTVRNGRIKLQAAHFVQTVNCLAQEYAETYNADFYVPSKENGQKP
FFLGHPVEQTERWIRTVKLVDRSSTSRQIQVEQNQSPPISILLSFNSTVGMTVLYHGSELGEFVATIHLDAHSNRFINIT
AMNCKGTLIGQLYRSNRQETTELVFSSYVGGEDRLQNSTIRIGAPATVNGSRWLCLQPYEKPKLQKCRWATFSAQPLPKV
ELPHRWTQAQGHCTDCNQISVNNFLKYLNPANWTQGVNGWSEAMAVGLEVAFYLLLAVILCAVCRRLICPVLRWTICGNG
RTNANKL