TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6NBB0|E6NBB0_9ARCH Uncharacterized protein OS=Candidatus Caldiarchaeum subterraneum OX=311458 GN=HGMM_F53G09C10 PE=4 SV=1
MGKSPICALVGELYPRPGESLPITSWDSRPVLSASVASPIQPGVLASLTYKVNVRPDVSPGVYTAELRLSYRDCTSSSDL
LPQSTQTIPLNLVIYEPPRPKFIDYRWIVDGVETTVGPGTGQAFLELVFEAPVESSVANVEGWLTLPDEFGGGVVYANYL
QQIPASGVFRLMFPIIVPDTVKVGEKNFGLTLSHRNKFGTLIKTDYSIQVDVGGRADVSAVIYTPSFTANSVSILNYLIT
NNGTAPAYNVELNIRSEIPTIRVLQPVYTIGTIEPGRTTQVPVPIFIDKTTQPSLYGLSSTISYRDLQGNIRSKQFSMPF
VVEENAKPGFTARTSQPFITAAHTTPVSIIFTNKNPFPARDVKIAIRSSSQQVVIIEGDTDLFIPVIQPGQTISTQLRLL
AIPQAGDTVIPIKTSLEYKDDIGLPVTETLDINLAVTADISIRLRSLALSPQRVQPGETVDIAGDVVNEGTGIARAVYVE
IDGQPPFKVLGEPSTFIGQINPSQVAAFTLNFIVDSQAKPGTYEVNVKVVYKNGFGDEFQASRTLVYQVVERQQTSIILP
QPASSSPVNPLIVLLVVAAALAAVILIVRRRGRREAG