TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E7RSN2|E7RSN2_9BACT Uncharacterized protein OS=Prevotella oralis ATCC 33269 GN=HMPREF0663_12300 PE=4 SV=1
MKMKYLFLIGISLTALPMAAQETYEDTKLVENDLNGTARYVGMGGAMDALGADLSTISSNPAGLGLFRRSMATLSFGMVS
QQDGKNFRNGNKTNASFDQIGFVYTMRENRNSFLNIGFNYHKSRNFDYILSAAGGLKDASQNTQSFLKGIAGGDKDTQSK
FNIANDHGNLKGVDPRTSQLDNLYYNAFLANSNGQLARNTANAYVMNRANTGYIGEYDFNISGNINDRIYLGVTFGLHDV
HYKGVSEYAENLLNYKNENVGTVAINDERRITGTGFDVKIGAIFRPIESSPFRIGLSIATPTWYSLTTQNYTYLVNGTQY
QGYNPNYTTGASYDFKLYTPWKFGVSLGHTVGKYLALGASYEYADYGSMDNRINDGTHYSYFYDEYYEASHSDRAMNDHT
KETLKGVSTFKIGAEVKASPEFAIRLGYNYLSPMFNKNGFKNSLVDSYGTNYSSATDYTNWKATNRLTLGLGYAVKNFSV
DLAYQYSVTKGDFYPFMDSYGDFWSLNTNTNKIEKEAISNNANAVSVNNKRHQLLLTLGYRF