TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E8UCW3|E8UCW3_TAYEM Outer membrane protein OS=Taylorella equigenitalis (strain MCE9) GN=TEQUI_1301 PE=4 SV=1
MKSKFFLYCTLYVISINCQSIETHNEISNDFNVQTKNFISNTNENSLLDTSLISQTQNATYITINGSTYLVPHTEHDLRL
AIYHAINANLWGDLSELIEIYQTLPNHQKQLVYMAQGLLERSRGYINKALTHMQRAYDINKEDLRVQLELARLYFEDYNN
RQSKKIFNSLAQSYELPNYTKGLINEYQSAINSQYKWQGNIGLSIGYDSNINQGNGIRQCVFNFMDTCVIYRNLPPPIGS
SYLGLNFDLSKRYALSDNNDLEISARFQGAKYSKTDSKALFLTDYSNFSSSAKISYIYRDSVKKVMLYPEFEILHKNKST
YYQSPSINLNTEIQLSRRLNLNSNFSFKWINYEGENKKYFEDYKQVNVGLGLVFEPSKNTFLYTNFDFYRNLYLTNYSSS
KEQSIRIGAYKYLSSGVYLHALAMYRDTKNDVANFLSFEPRHDNTKIAILSIGLPKISFKGVVPELRFKYIQNKSNIDFY
IYTQREISLNLNYSF