TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9AJK7|E9AJK7_LEIMU Putative uncharacterized protein OS=Leishmania mexicana (strain MHOM/GT/2001/U1103) GN=LMXM_02_0450 PE=4 SV=1
MTTLFKDYSKGSNDLLTKNFSSCGAWKVESKSKAPKGTYALTTTSNTHGDVKLDIEGLTGDGAYYGKLCFTSKDLTDIQL
TVRAEDLDNHRVEAIIGHKGPAVCDISVEVNHQTVRPIAGGCLSVNEKFTQKAVELALSMAAVDGVQVGCGTKYDLKSKT
IDWTAGCRMEAKNGLVMTAQTNRSLDVTASMISKAALHPKFQPCVAATVTMNPQSMTWDGSVALEWGCQVILGNAAKIRF
SKNLDWVASYIANLRDGWTVVLSMDKTMRAGLTLTRN