TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9BBC3|E9BBC3_LEIDB Uncharacterized protein OS=Leishmania donovani (strain BPK282A1) GN=LDBPK_130490 PE=4 SV=1
MPSALRCHSTTAADASAKAKLTSPGAPLTHVLKPIPTSGAASSFSVTPSAVVLHTSYASLSAADEVGHDESRSRGADAGD
GSTRTAHLTATPSYAVTNVAAFEQLIAEALRLSEVTLEAAATVGAPPAPSPSSPVLATSASRGSAREAPITLIADHTVRE
LQVLLAEAERTLAPFTARKARIDKFVYGVYLPLLKYGTFAFFAAQLVVYFNWIFFVFDWNLVEPTTYFLAYTGIFCSLVY
HYYHCSGDGSTWKDMFQHLARRKAEKKYAQVQLDVVGMAQLQRRITLIKKELARMSV